PDB entry 3t8n

View 3t8n on RCSB PDB site
Description: Crystal structure of ketosteroid isomerase Y16AD103A from Pseudomonas putida
Class: isomerase
Keywords: Isomerase
Deposited on 2011-08-01, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.188
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (15)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d3t8na_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (Start-130)
      • engineered mutation (15)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d3t8nb_
  • Chain 'D':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-End)
      • engineered mutation (15)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d3t8nd_
  • Chain 'F':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-End)
      • engineered mutation (15)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d3t8nf_
  • Heterogens: SO4, EDT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t8nA (A:)
    mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t8nA (A:)
    nlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayws
    evnlsvrep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t8nB (B:)
    mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t8nB (B:)
    nlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayws
    evnlsvrepq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3t8nD (D:)
    mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t8nD (D:)
    mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw
    sevnlsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3t8nF (F:)
    mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t8nF (F:)
    mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw
    sevnlsvrep