PDB entry 3t88

View 3t88 on RCSB PDB site
Description: Crystal structure of Escherichia coli MenB in complex with substrate analogue, OSB-NCoA
Class: lyase/lyase inhibitor
Keywords: crotonase superfamily, LYASE-LYASE INHIBITOR complex
Deposited on 2011-08-01, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:562]
    Gene: b2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t88a_
  • Chain 'B':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:562]
    Gene: b2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t88b_
  • Chain 'C':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:562]
    Gene: b2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t88c_
  • Chain 'D':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:562]
    Gene: b2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t88d_
  • Chain 'E':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:562]
    Gene: b2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t88e_
  • Chain 'F':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:562]
    Gene: b2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t88f_
  • Heterogens: S0N, CL, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t88A (A:)
    gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
    iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
    tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
    qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
    nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t88A (A:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
    mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
    flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
    glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t88B (B:)
    gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
    iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
    tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
    qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
    nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t88B (B:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
    mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
    flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
    glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t88C (C:)
    gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
    iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
    tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
    qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
    nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t88C (C:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
    mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
    flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
    glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3t88D (D:)
    gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
    iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
    tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
    qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
    nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t88D (D:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
    mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
    flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
    glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3t88E (E:)
    gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
    iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
    tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
    qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
    nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t88E (E:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
    mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
    flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
    glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3t88F (F:)
    gshmmiypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkem
    iqaladaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqir
    tcpkpvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivg
    qkkareiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaal
    nadcdgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t88F (F:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
    mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
    flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
    glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp