PDB entry 3t7b

View 3t7b on RCSB PDB site
Description: Crystal Structure of N-acetyl-L-glutamate kinase from Yersinia pestis
Class: transferase
Keywords: structural genomics, center for structural genomics of infectious diseases, csgid, amino acid kinase, acetylglutamate kinase, transferase
Deposited on 2011-07-29, released 2011-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: Yersinia pestis [TaxId:214092]
    Gene: argB, y0311, YPO3925, YP_3124
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZA87 (3-259)
      • expression tag (2)
    Domains in SCOPe 2.07: d3t7ba1, d3t7ba2
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: Yersinia pestis [TaxId:214092]
    Gene: argB, y0311, YPO3925, YP_3124
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZA87 (3-259)
      • expression tag (2)
    Domains in SCOPe 2.07: d3t7bb1, d3t7bb2
  • Heterogens: GLU, SRT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t7bA (A:)
    snamnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalp
    vvkknglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldae
    lghvgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlil
    lsdvsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswr
    hseqlpalfngvpigtrisv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t7bA (A:)
    amnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvv
    kknglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelg
    hvgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlills
    dvsgildqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhseql
    palfngvpigtrisv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t7bB (B:)
    snamnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalp
    vvkknglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldae
    lghvgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlil
    lsdvsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswr
    hseqlpalfngvpigtrisv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t7bB (B:)
    amnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvv
    kknglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelg
    hvgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlills
    dvsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhs
    eqlpalfngvpigtrisv