PDB entry 3t6l

View 3t6l on RCSB PDB site
Description: Y54F mutant of core streptavidin
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 2011-07-28, released 2011-12-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.137
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (41)
    Domains in SCOPe 2.01: d3t6la_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t6lA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6lA (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp