PDB entry 3t6f

View 3t6f on RCSB PDB site
Description: Biotin complex of Y54F core streptavidin
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 2011-07-28, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (41)
    Domains in SCOPe 2.07: d3t6fa_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (41)
    Domains in SCOPe 2.07: d3t6fb_
  • Heterogens: BTN, BSO, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t6fA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6fA (A:)
    eagitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t6fB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6fB (B:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    ps