PDB entry 3t57

View 3t57 on RCSB PDB site
Description: Activity and Crystal Structure of Arabidopsis UDP-N-acetylglucosamine acyltransferase
Class: transferase
Keywords: left-handed parallel beta helix, acyltransferase, lipid A biosynthesis, lipid synthesis, acylation, TRANSFERASE
Deposited on 2011-07-26, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine O-acyltransferase domain-containing protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g29540, lpxA, T16L4.50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t57a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t57A (A:)
    mdsrdsevlihpsavvhpnavigkgvsvgpyctigssvklgngcklypsshvfgntelge
    scvlmtgavvgdelpgytfigcnniighhavvgvkcqdlkykhgdecflcignnneiref
    csihrsskpsdktvigdnnlimgschiahdckigdrnifanntllaghvvvednthtaga
    svvhqfchigsfafigggsvvsqdvpkymmvageraelrglnleglrrngftmsemkslr
    aayrkifmstetvslsfeerlteleqdqelysvpavsamlqsirdsftesrrgickfrqw
    ldstt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t57A (A:)
    lihpsavvhpnavigkgvsvgpyctigssvklgngcklypsshvfgntelgescvlmtga
    vvgdelpgytfigcnniighhavvgvkcqdlkykhgdecflcignnneirefcsihrssk
    psdktvigdnnlimgschiahdckigdrnifanntllaghvvvednthtagasvvhqfch
    igsfafigggsvvsqdvpkymmvageraelrglnleglrrngftmsemkslraayrkifm
    stetvslsfeerlteleqdqelysvpavsamlqsirdsftesrrgick