PDB entry 3t4x

View 3t4x on RCSB PDB site
Description: Short chain dehydrogenase/reductase family oxidoreductase from Bacillus anthracis str. Ames Ancestor
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2011-07-26, released 2011-08-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short chain dehydrogenase/reductase family
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3188, BA_3440, GBAA_3440
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81MX9 (3-266)
      • expression tag (2)
    Domains in SCOPe 2.05: d3t4xa_
  • Chain 'B':
    Compound: Oxidoreductase, short chain dehydrogenase/reductase family
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3188, BA_3440, GBAA_3440
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81MX9 (3-266)
      • expression tag (2)
    Domains in SCOPe 2.05: d3t4xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t4xA (A:)
    snamhmqlkgktalvtgstagigkaiatslvaeganvlingrreenvnetikeiraqypd
    ailqpvvadlgteqgcqdviekypkvdilinnlgifepveyfdipdedwfklfevnimsg
    vrltrsylkkmierkegrvifiaseaaimpsqemahysatktmqlslsrslaelttgtnv
    tvntimpgstltegvetmlnslypneqltieeaekrfmkenrptsiiqrlirpeeiahlv
    tflssplssaingsalridgglvrsvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t4xA (A:)
    amhmqlkgktalvtgstagigkaiatslvaeganvlingrreenvnetikeiraqypdai
    lqpvvadlgteqgcqdviekypkvdilinnlgifepveyfdipdedwfklfevnimsgvr
    ltrsylkkmierkegrvifiaseaaimpsqemahysatktmqlslsrslaelttgtnvtv
    ntimpgstltegvetmlnslypneqltieeaekrfmkenrptsiiqrlirpeeiahlvtf
    lssplssaingsalridgglvrsvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t4xB (B:)
    snamhmqlkgktalvtgstagigkaiatslvaeganvlingrreenvnetikeiraqypd
    ailqpvvadlgteqgcqdviekypkvdilinnlgifepveyfdipdedwfklfevnimsg
    vrltrsylkkmierkegrvifiaseaaimpsqemahysatktmqlslsrslaelttgtnv
    tvntimpgstltegvetmlnslypneqltieeaekrfmkenrptsiiqrlirpeeiahlv
    tflssplssaingsalridgglvrsvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t4xB (B:)
    amhmqlkgktalvtgstagigkaiatslvaeganvlingrreenvnetikeiraqypdai
    lqpvvadlgteqgcqdviekypkvdilinnlgifepveyfdipdedwfklfevnimsgvr
    ltrsylkkmierkegrvifiaseaaimpsqemahysatktmqlslsrslaelttgtnvtv
    ntimpgstltegvetmlnslypneqltieeaekrfmkenrptsiiqrlirpeeiahlvtf
    lssplssaingsalridgglvrsvf