PDB entry 3t4e

View 3t4e on RCSB PDB site
Description: 1.95 Angstrom Crystal Structure of Shikimate 5-dehydrogenase (AroE) from Salmonella enterica subsp. enterica serovar Typhimurium in Complex with NAD
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, NAD(P)-binding Rossmann-fold C-terminal domain, Aminoacid dehydrogenase-like N-terminal domain, NAD, OXIDOREDUCTASE
Deposited on 2011-07-25, released 2011-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.168
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinate/shikimate dehydrogenase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: aroE, STM1359, ydiB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3t4ea1, d3t4ea2
  • Chain 'B':
    Compound: Quinate/shikimate dehydrogenase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: aroE, STM1359, ydiB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3t4eb1, d3t4eb2
  • Heterogens: NAD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t4eA (A:)
    mhhhhhhssgvdlgtenlyfqsnamdvtakyeliglmaypirhslspemqnkalekaglp
    ytymafevdnttfasaieglkalkmrgtgvsmpnkqlaceyvdeltpaaklvgaintivn
    ddgylrgyntdgtghiraikesgfdmrgktmvllgaggaataigaqaaiegikeiklfnr
    kddffekavafakrvnentdcvvtvtdladqhaftealasadiltngtkvgmkplenesl
    igdvsllrpellvtecvynphmtkllqqaqqagcktidgygmllwqgaeqfelwtgkafp
    ldyvkqvmgfta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t4eA (A:)
    kyeliglmaypirhslspemqnkalekaglpytymafevdnttfasaieglkalkmrgtg
    vsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdmrgk
    tmvllgaggaataigaqaaiegikeiklfnrkddffekavafakrvnentdcvvtvtdla
    dqhaftealasadiltngtkvgmkplenesligdvsllrpellvtecvynphmtkllqqa
    qqagcktidgygmllwqgaeqfelwtgkafpldyvkqvmgfta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t4eB (B:)
    mhhhhhhssgvdlgtenlyfqsnamdvtakyeliglmaypirhslspemqnkalekaglp
    ytymafevdnttfasaieglkalkmrgtgvsmpnkqlaceyvdeltpaaklvgaintivn
    ddgylrgyntdgtghiraikesgfdmrgktmvllgaggaataigaqaaiegikeiklfnr
    kddffekavafakrvnentdcvvtvtdladqhaftealasadiltngtkvgmkplenesl
    igdvsllrpellvtecvynphmtkllqqaqqagcktidgygmllwqgaeqfelwtgkafp
    ldyvkqvmgfta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t4eB (B:)
    takyeliglmaypirhslspemqnkalekaglpytymafevdnttfasaieglkalkmrg
    tgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdmr
    gktmvllgaggaataigaqaaiegikeiklfnrkddffekavafakrvnentdcvvtvtd
    ladqhaftealasadiltngtkvgmkplenesligdvsllrpellvtecvynphmtkllq
    qaqqagcktidgygmllwqgaeqfelwtgkafpldyvkqvmgf