PDB entry 3t3s

View 3t3s on RCSB PDB site
Description: Human Cytochrome P450 2A13 in complex with Pilocarpine
Class: oxidoreductase
Keywords: CYP2A13, cytochrome P450 2A13, P450 2A13, heme protein, monooxygenase, drug metabolism, xenobiotic metabolism, endoplasmic reticulum, membrane, OXIDOREDUCTASE
Deposited on 2011-07-25, released 2011-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sa_
  • Chain 'B':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sb_
  • Chain 'C':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sc_
  • Chain 'D':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sd_
  • Chain 'E':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3se_
  • Chain 'F':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sf_
  • Chain 'G':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sg_
  • Chain 'H':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t3sh_
  • Heterogens: HEM, 9PL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t3sA (A:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sA (A:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t3sB (B:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sB (B:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t3sC (C:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sC (C:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3t3sD (D:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sD (D:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3t3sE (E:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sE (E:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3t3sF (F:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sF (F:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3t3sG (G:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sG (G:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3t3sH (H:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3sH (H:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr