PDB entry 3t32

View 3t32 on RCSB PDB site
Description: Crystal structure of a putative C-S lyase from Bacillus anthracis
Class: lyase
Keywords: Structural Genomics, CSGID, Center for Structural Genomics of Infectious Diseases, aminotransferase, LYASE
Deposited on 2011-07-24, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase, class I/II
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAS4776, BA_5138, GBAA_5138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t32a_
  • Chain 'B':
    Compound: Aminotransferase, class I/II
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAS4776, BA_5138, GBAA_5138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t32b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t32A (A:)
    mqlfhktvnrrgthsikwdtykneelihawiadmdfevpqpiqtalkkriehpifgytlp
    penigdiicnwtkkqynwdiqkewivfsagivpalstsiqaftkenesvlvqppiyppff
    emvttnnrqlcvsplqkqndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltk
    lgslctkynvivvadeihsdiiyadhthtpfaslseelaartitcmapsktfniaglqas
    iiiipneklrqaftsiqyrqgfhglnifaytamqsaytecndwlneirfyiednakface
    yikdhiptlsvmkpegsfllwidcsalnlsqdertklleekgkiivepgekyglggeehi
    ginigcprsvleeilnrlrhtfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t32A (A:)
    eelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqynwdiqke
    wivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkqndtya
    idfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeihsdiiy
    adhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqyrqgfh
    glnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpegsfllwid
    csalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeilnrlrhtfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t32B (B:)
    mqlfhktvnrrgthsikwdtykneelihawiadmdfevpqpiqtalkkriehpifgytlp
    penigdiicnwtkkqynwdiqkewivfsagivpalstsiqaftkenesvlvqppiyppff
    emvttnnrqlcvsplqkqndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltk
    lgslctkynvivvadeihsdiiyadhthtpfaslseelaartitcmapsktfniaglqas
    iiiipneklrqaftsiqyrqgfhglnifaytamqsaytecndwlneirfyiednakface
    yikdhiptlsvmkpegsfllwidcsalnlsqdertklleekgkiivepgekyglggeehi
    ginigcprsvleeilnrlrhtfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t32B (B:)
    eelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqynwdiqke
    wivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkqndtya
    idfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeihsdiiy
    adhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqyrqgfh
    glnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpegsfllwid
    csalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeilnrlrhtfs