PDB entry 3t30

View 3t30 on RCSB PDB site
Description: Human nucleoplasmin (Npm2): a histone chaperone in oocytes and early embryos
Class: chaperone
Keywords: beta-barrel jelly roll topology, Histone chaperone, H2A-H2B dimer and H3-H4 tetramer, oocytes and early embryos, CHAPERONE
Deposited on 2011-07-23, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30a_
  • Chain 'B':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30b_
  • Chain 'C':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30c_
  • Chain 'D':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30d_
  • Chain 'E':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30e_
  • Chain 'F':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30f_
  • Chain 'G':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30g_
  • Chain 'H':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30h_
  • Chain 'I':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30i_
  • Chain 'J':
    Compound: Nucleoplasmin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t30j_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t30A (A:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30A (A:)
    tvlwgcelsqerrtwtfrpcrlllhticlgekakeemhrveilppanmqpvtiaslqasv
    lpmvsmvgvqlsppvtfqlragsgpvflsgqer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t30B (B:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30B (B:)
    ttvlwgcelsqerrtwtfrscrlllhticlgekakeemhrveilppqpvtiaslqasvlp
    mvsmvgvqlsppvtfqlragsgpvflsgqery
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t30C (C:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30C (C:)
    ttvlwgcelsqerrtwtfrpqscrlllhticlgekakeemhrveilppmqpvtiaslqas
    vlpmvsmvgvqlsppvtfqlragsgpvflsgqery
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3t30D (D:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30D (D:)
    ttvlwgcelsqerrtwtfrpcrlllhticlgekakeemhrveilppvtiaslqasvlpmv
    smvgvqlsppvtfqlragsgpvflsgqery
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3t30E (E:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30E (E:)
    vlwgcelsqerrtwtfrpqscrlllhticlgekakeemhrveilppaqpvtiaslqasvl
    pmvsmvgvqlsppvtfqlragsgpvflsgqer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3t30F (F:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30F (F:)
    tvlwgcelsqerrtwtfrpqcrlllhticlgekakeemhrveilppqpvtiaslqasvlp
    mvsmvgvqlsppvtfqlragsgpvflsgqer
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3t30G (G:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30G (G:)
    ttvlwgcelsqerrtwtfrpqcrlllhticlgekakeemhrveilppamqpvtiaslqas
    vlpmvsmvgvqlsppvtfqlragsgpvflsgqer
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3t30H (H:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30H (H:)
    ttvlwgcelsqerrtwtfrpscrlllhticlgekakeemhrveilppqpvtiaslqasvl
    pmvsmvgvqlsppvtfqlragsgpvflsgqery
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3t30I (I:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30I (I:)
    ttvlwgcelsqerrtwtfrpscrlllhticlgekakeemhrveilpppvtiaslqasvlp
    mvsmvgvqlsppvtfqlragsgpvflsgqery
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3t30J (J:)
    mvttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqed
    kkmqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqerye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t30J (J:)
    ttvlwgcelsqerrtwtfcrlllhticlgekakeemhrveilppaqpvtiaslqasvlpm
    vsmvgvqlsppvtfqlragsgpvflsgqer