PDB entry 3t2w

View 3t2w on RCSB PDB site
Description: Crystal structure of shwanavidin (F43A) - biotin complex
Class: Biotin-binding protein
Keywords: avidin, streptavidin, biotin, high affinity systems, shwanavidin, Biotin-binding protein
Deposited on 2011-07-23, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6
      • engineered mutation (42)
    Domains in SCOPe 2.07: d3t2wa_
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3t2wA (A:)
mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgta
isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
sa

    Sequence, based on observed residues (ATOM records): (download) 
    >3t2wA (A:)
aqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyingqgkistlwqlvvngssspsqilkgqdvfsqt