PDB entry 3t22

View 3t22 on RCSB PDB site
Description: Crystal structure of OxyR mutant from Porphyromonas gingivalis
Class: transcription regulator
Keywords: beta-alpha-barrels, DNA-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2011-07-22, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redox-sensitive transcriptional activator OxyR
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: oxyR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20K61 (Start-218)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3t22a_
  • Chain 'B':
    Compound: Redox-sensitive transcriptional activator OxyR
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: oxyR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20K61
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3t22b_
  • Chain 'C':
    Compound: Redox-sensitive transcriptional activator OxyR
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: oxyR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20K61 (Start-218)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3t22c_
  • Chain 'D':
    Compound: Redox-sensitive transcriptional activator OxyR
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: oxyR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20K61
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3t22d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t22A (A:)
    tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
    aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcq
    mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
    rlavrqdysrrklreqligllrsavpsdmhklqtgqhlahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t22A (A:)
    grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
    etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm
    aysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavrqdys
    rrklreqligllrsavpsdmhklqtgqhla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t22B (B:)
    tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
    aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcq
    mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
    rlavrqdysrrklreqligllrsavpsdmhklqtgqhlahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t22B (B:)
    grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
    etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcay
    sggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavrqdysrr
    klreqligllrsavpsdmhklqtgqhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t22C (C:)
    tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
    aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcq
    mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
    rlavrqdysrrklreqligllrsavpsdmhklqtgqhlahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t22C (C:)
    grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
    etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm
    kgltaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavr
    qdysrrklreqligllrsavpsdmhklqtgqhla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3t22D (D:)
    tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
    aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcq
    mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
    rlavrqdysrrklreqligllrsavpsdmhklqtgqhlahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t22D (D:)
    lniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaskaet
    egleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqmta
    ysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavrqdysr
    rklreqligllrsavpsdmhklqtgqhl