PDB entry 3t16

View 3t16 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant NVIAGA/M98G at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, HYDROLASE
Deposited on 2011-07-21, released 2011-08-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (20)
      • engineered mutation (32)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (97)
      • engineered mutation (116)
      • engineered mutation (127)
    Domains in SCOPe 2.05: d3t16a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t16A (A:)
    atstkklhkepatlikaidgntvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkgvnealvrqglakvayvykgnnt
    heqhlrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t16A (A:)
    lhkepatlikaidgntvklmykgqpmvfrlllvdipygpeaaaftkkmvenakkievefd
    kgqrtdkygrglayiyadgkgvnealvrqglakvayvykgnntheqhlrkaeaqakkekl
    niws