PDB entry 3szh

View 3szh on RCSB PDB site
Description: Crystal structure of apo shwanavidin (P1 form)
Class: Biotin-binding protein
Keywords: high affinity systems, avidin, streptavidin, biotin, shwanavidin, Biotin-binding protein
Deposited on 2011-07-19, released 2012-04-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.16
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3szha_
  • Chain 'B':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3szhb_
  • Chain 'C':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d3szhc1, d3szhc2
  • Chain 'D':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3szhd_
  • Chain 'E':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3szhe_
  • Chain 'F':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3szhf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3szhA (A:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3szhA (A:)
    qeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfs
    tkwlnsvescnsitswsgfyingqgkistlwqlvvngssspsqilkgqdvfsqts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3szhB (B:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3szhB (B:)
    maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
    fstkwlnsvescnsitswsgfyingqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3szhC (C:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3szhC (C:)
    amaqeltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtais
    fstkwlnsvescnsitswsgfyintgqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3szhD (D:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3szhD (D:)
    maqeltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintgqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3szhE (E:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3szhE (E:)
    aqeltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisfs
    tkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3szhF (F:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3szhF (F:)
    aqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt