PDB entry 3sz3

View 3sz3 on RCSB PDB site
Description: Crystal structure of Tryptophanyl-tRNA synthetase from Vibrio cholerae with an endogenous tryptophan
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Rossmann Fold, LIGASE
Deposited on 2011-07-18, released 2011-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: trpS, VC_2623
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KNV7 (3-340)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3sz3a1, d3sz3a2
  • Heterogens: TRP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sz3A (A:)
    snamskpivlsgvqpsgelsignylgalrqwqqmqddydcqycvvdlhaitvrqdpqalh
    eatldalaiclavgvdpkkstlfvqshvpehaqlgwvlncytqmgelsrmtqfkdksary
    andvnaglfgypvlmaadillygahqvpvgsdqkqhlelardiatrfnniyspeqpifti
    pepyiptvnarvmslqdatkkmsksddnrknvitlledpksiikkinkaqtdaetppria
    ydvenkagianlmglysaatgktfaeieaqyagvemygpfkkdvgeavvamlepvqaeyq
    rirndreylnsvmrdgaekasakalqtlkkvyaavgfvarp