PDB entry 3syx
View 3syx on RCSB PDB site
Description: Crystal Structure of the WH1 domain from human sprouty-related, EVH1 domain-containing protein. Northeast Structural Genomics Consortium Target HR5538B.
Class: signaling protein
Keywords: WH1 domain, Human sprouty-related, EVH1 domain-containing protein, Q7Z699, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, PSI-Biology, SIGNALING PROTEIN
Deposited on
2011-07-18, released
2011-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-08-03, with a file datestamp of
2011-07-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.23
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Sprouty-related, EVH1 domain-containing protein 1
Species: Homo sapiens [TaxId:9606]
Gene: Spred1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3syxa1, d3syxa2 - Heterogens: YT3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3syxA (A:)
mghhhhhhshmsyarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffir
gerlrdkmvvlecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraie
disqgcpesk
Sequence, based on observed residues (ATOM records): (download)
>3syxA (A:)
shmsyarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffirgerlrdkm
vvlecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisqgc