PDB entry 3syu

View 3syu on RCSB PDB site
Description: Re-refined coordinates for pdb entry 1det - ribonuclease T1 carboxymethylated at GLU 58 in complex with 2'GMP
Class: hydrolase
Keywords: hydrolase, endoribonuclease
Deposited on 2011-07-18, released 2012-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.14
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease t1
    Species: Aspergillus oryzae [TaxId:510516]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3syua_
  • Heterogens: NA, 2GP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3syuA (A:)
acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

    Sequence, based on observed residues (ATOM records): (download) 
    >3syuA (A:)
cdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewpi
lssgdvysggspgadrvvfnennqlagvithtgasgnnfvect