PDB entry 3sy0

View 3sy0 on RCSB PDB site
Description: S25-2- A(2-8)-A(2-4)KDO trisaccharide complex
Class: immune system
Keywords: antigen-binding fragment, FAB, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, immune system
Deposited on 2011-07-15, released 2011-08-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.19
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S25-2 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SY0 (0-218)
    Domains in SCOPe 2.05: d3sy0a1, d3sy0a2
  • Chain 'B':
    Compound: S25-2 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SY0 (0-221)
    Domains in SCOPe 2.05: d3sy0b1, d3sy0b2
  • Heterogens: MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sy0A (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sy0B (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr