PDB entry 3sxw

View 3sxw on RCSB PDB site
Description: Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR69.
Class: isomerase
Keywords: Engineered protein, Structural Genomics, PSI-biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, ISOMERASE
Deposited on 2011-07-15, released 2011-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (2-End)
      • expression tag (1)
      • engineered mutation (70)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (86)
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (109)
      • engineered mutation (111)
      • engineered mutation (123)
      • engineered mutation (129)
      • engineered mutation (131)
      • engineered mutation (137)
      • engineered mutation (139)
      • engineered mutation (149)
      • engineered mutation (151)
    Domains in SCOPe 2.08: d3sxwa1, d3sxwa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sxwA (A:)
    mmmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyave
    qeekegdlnfsthviypgkvgkefffakghfhakldraqvavalkgkggvlmqtpegdak
    wissepgtviysppywaaravnigdepfimlviypadaghdygtiaekgfskivieenge
    vkvvdnprwkkgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxwA (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfsthviypgkvgkefffakghfhakldraqvavalkgkggvlmqtpegdakw
    issepgtviysppywaaravnigdepfimlviypadaghdygtiaekgfskivieengev
    kvvdnprw