PDB entry 3sxr

View 3sxr on RCSB PDB site
Description: Crystal structure of BMX non-receptor tyrosine kinase complex with dasatinib
Class: transferase/transferase inhibitor
Keywords: transferase-transferase inhibitor complex
Deposited on 2011-07-15, released 2011-09-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic tyrosine-protein kinase BMX
    Species: Homo sapiens [TaxId:9606]
    Gene: AGMX1, ATK, BMX, BPK, BTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51813 (3-End)
      • expression tag (0-2)
      • engineered mutation (24)
      • engineered mutation (203)
      • engineered mutation (209)
      • engineered mutation (212)
    Domains in SCOPe 2.04: d3sxra_
  • Chain 'B':
    Compound: Cytoplasmic tyrosine-protein kinase BMX
    Species: Homo sapiens [TaxId:9606]
    Gene: AGMX1, ATK, BMX, BPK, BTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51813 (3-End)
      • expression tag (0-2)
      • engineered mutation (24)
      • engineered mutation (203)
      • engineered mutation (209)
      • engineered mutation (212)
    Domains in SCOPe 2.04: d3sxrb_
  • Heterogens: 1N1, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sxrA (A:)
    ghmelkreeitllkelgsgqfgvvklgkwkgqydvavkmikegsmsedeffqeaqtmmkl
    shpklvkfygvcskeypiyivteyisngcllnylrshgkglepsqllemcydvcegmafl
    eshqfihrdlaarnclvdrdlcvkvsdfgmtryvlddqyvssvgtkfpvkwsapevfhyf
    kyssksdvwafgilmwevfslgkmpydlytnsevvlkvsqghrlyrphlasdtiyqimys
    cwhelpekrptfqqllssieplrekdkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxrA (A:)
    ghmelkreeitllkelgsvvklgkwkgqydvavkmikegsmsedeffqeaqtmmklshpk
    lvkfygvcskeypiyivteyisngcllnylrshgkglepsqllemcydvcegmafleshq
    fihrdlaarnclvdrdlcvkvsdfgmtryvlddqyvssvgtkfpvkwsapevfhyfkyss
    ksdvwafgilmwevfslgkmpydlytnsevvlkvsqghrlyrphlasdtiyqimyscwhe
    lpekrptfqqllssieplre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sxrB (B:)
    ghmelkreeitllkelgsgqfgvvklgkwkgqydvavkmikegsmsedeffqeaqtmmkl
    shpklvkfygvcskeypiyivteyisngcllnylrshgkglepsqllemcydvcegmafl
    eshqfihrdlaarnclvdrdlcvkvsdfgmtryvlddqyvssvgtkfpvkwsapevfhyf
    kyssksdvwafgilmwevfslgkmpydlytnsevvlkvsqghrlyrphlasdtiyqimys
    cwhelpekrptfqqllssieplrekdkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxrB (B:)
    ghmelkreeitllkelvvklgkwkgqydvavkmikegsmsedeffqeaqtmmklshpklv
    kfygvcskeypiyivteyisngcllnylrshgkglepsqllemcydvcegmafleshqfi
    hrdlaarnclvdrdlcvkvsdfgmtryvlddqyvssvgtkfpvkwsapevfhyfkyssks
    dvwafgilmwevfslgkmpydlytnsevvlkvsqghrlyrphlasdtiyqimyscwhelp
    ekrptfqqllssieplre