PDB entry 3sxp

View 3sxp on RCSB PDB site
Description: Crystal Structure of Helicobacter pylori ADP-L-glycero-D-manno-heptose-6-epimerase (rfaD, HP0859)
Class: isomerase
Keywords: Rossmann fold, Epimerase, NAD binding, ISOMERASE
Deposited on 2011-07-15, released 2012-02-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.239
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-L-glycero-D-mannoheptose-6-epimerase
    Species: Helicobacter pylori [TaxId:563041]
    Gene: hp0859, HPG27_813
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Z7L9 (0-End)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sxpa_
  • Chain 'B':
    Compound: ADP-L-glycero-D-mannoheptose-6-epimerase
    Species: Helicobacter pylori [TaxId:563041]
    Gene: hp0859, HPG27_813
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Z7L9 (0-End)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sxpb_
  • Chain 'C':
    Compound: ADP-L-glycero-D-mannoheptose-6-epimerase
    Species: Helicobacter pylori [TaxId:563041]
    Gene: hp0859, HPG27_813
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Z7L9 (0-End)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sxpc_
  • Chain 'D':
    Compound: ADP-L-glycero-D-mannoheptose-6-epimerase
    Species: Helicobacter pylori [TaxId:563041]
    Gene: hp0859, HPG27_813
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Z7L9 (0-End)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sxpd_
  • Chain 'E':
    Compound: ADP-L-glycero-D-mannoheptose-6-epimerase
    Species: Helicobacter pylori [TaxId:563041]
    Gene: hp0859, HPG27_813
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Z7L9 (0-End)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sxpe_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sxpA (A:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg
    hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl
    nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv
    qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv
    kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil
    dldytplydlesgikdylphihaifkgqrakgelnsklegkpipnllgldstrtghhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxpA (A:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig
    fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar
    skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf
    nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk
    sgvynvgysqarsyneivsilkehlgdfkvtyikkhtqahieptildldytplydlesgi
    kdylphihai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sxpB (B:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg
    hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl
    nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv
    qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv
    kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil
    dldytplydlesgikdylphihaifkgqrakgelnsklegkpipnllgldstrtghhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxpB (B:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig
    fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar
    skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf
    nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk
    sgvynvgysqarsyneivsilkehlgdfkvtyikqkhtqahieptildldytplydlesg
    ikdylphihai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sxpC (C:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg
    hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl
    nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv
    qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv
    kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil
    dldytplydlesgikdylphihaifkgqrakgelnsklegkpipnllgldstrtghhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxpC (C:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig
    fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar
    skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf
    nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk
    sgvynvgysqarsyneivsilkehlgdfkvtyikkhtqahieptildldytplydlesgi
    kdylphihai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sxpD (D:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg
    hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl
    nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv
    qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv
    kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil
    dldytplydlesgikdylphihaifkgqrakgelnsklegkpipnllgldstrtghhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxpD (D:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig
    fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar
    skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf
    nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk
    sgvynvgysqarsyneivsilkehlgdfkvtyiknffqkhtqahieptildldytplydl
    esgikdylphihai
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sxpE (E:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg
    hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl
    nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv
    qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv
    kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil
    dldytplydlesgikdylphihaifkgqrakgelnsklegkpipnllgldstrtghhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxpE (E:)
    mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig
    fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar
    skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf
    nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk
    sgvynvgysqarsyneivsilkehlgdfkvtyikkhtqahieptildldytplydlesgi
    kdylphihai