PDB entry 3sxl

View 3sxl on RCSB PDB site
Description: sex-lethal RNA recognition domains 1 and 2 from drosophila melanogaster
Class: RNA binding domain
Keywords: RNA binding domain, rbd, RNA recognition motif, rrm, splicing inhibitor, translational inhibitor, sex determination, x chromosome dosage compensation
Deposited on 1999-04-04, released 1999-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sex-lethal)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19339
      • engineered (25)
      • engineered (46)
      • engineered (66)
    Domains in SCOPe 2.06: d3sxla1, d3sxla2
  • Chain 'B':
    Compound: protein (sex-lethal)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19339
      • engineered (25)
      • engineered (46)
      • engineered (66)
    Domains in SCOPe 2.06: d3sxlb1, d3sxlb2
  • Chain 'C':
    Compound: protein (sex-lethal)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19339
      • engineered (25)
      • engineered (46)
      • engineered (66)
    Domains in SCOPe 2.06: d3sxlc1, d3sxlc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sxlA (A:)
    mesddlmndprasntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyaf
    vdftsemdsqraikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldti
    fgkygsivqknilrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrlae
    ehgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxlA (A:)
    ntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyafvdftsemdsqrai
    kvlngitvrnkrlkvsyarpesikdtnlyvtnlprtitddqldtifgkygsivqknilrd
    kltgrprgvafvrynkreeaqeaisalnnvplsvrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sxlB (B:)
    mesddlmndprasntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyaf
    vdftsemdsqraikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldti
    fgkygsivqknilrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrlae
    ehgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxlB (B:)
    ntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyafvdftsemdsqrai
    kvlngitvrnkrlkvsyarpesikdtnlyvtnlprtitddqldtifgkygsivqknilrd
    kltgrprgvafvrynkreeaqeaisalnnvplsvrla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sxlC (C:)
    mesddlmndprasntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyaf
    vdftsemdsqraikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldti
    fgkygsivqknilrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrlae
    ehgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxlC (C:)
    ntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyafvdftsemdsqrai
    kvlngitvrnkrlkvsyarpesikdtnlyvtnlprtitddqldtifgkygsivqknilrd
    kltgrprgvafvrynkreeaqeaisalnnvplsvrla