PDB entry 3sxd

View 3sxd on RCSB PDB site
Description: Crystal structure of BBBB+UDP+Gal with MPD as the cryoprotectant
Class: transferase
Keywords: retaining glycosyltransferase, glycoprotein, blood group antigen, ABO Rossmann fold, metal-binding, manganese, TRANSFERASE
Deposited on 2011-07-14, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.193
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (2-End)
      • expression tag (0-1)
      • see remark 999 (114)
      • see remark 999 (173)
      • see remark 999 (204)
      • see remark 999 (206)
    Domains in SCOPe 2.07: d3sxda1, d3sxda2
  • Heterogens: UDP, GAL, PEG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sxdA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrw
    qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssr
    eaftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwh
    deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sxdA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgrrmem
    iscerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsq
    ayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrh
    kptkvlspeylwdqqllgwpavlrklrftavp