PDB entry 3swt

View 3swt on RCSB PDB site
Description: Crystal Structure of the Taurine catabolism dioxygenase, TauD from Mycobacterium marinum
Class: oxidoreductase
Keywords: Taurine catabolism dioxygenase, TauD, Seattle Structural Genomics Center for Infectious Disease, SSGCID, dioxygenase, OXIDOREDUCTASE
Deposited on 2011-07-14, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Taurine catabolism dioxygenase, TauD
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: tauD, MMAR_1141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3swta_
  • Chain 'B':
    Compound: Taurine catabolism dioxygenase, TauD
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: tauD, MMAR_1141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3swtb_
  • Heterogens: FE, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3swtA (A:)
    gpgsmtdlitvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddq
    qqlqfagllgtpighpaaaaalpdapiitpinsewgkanrwhtdvtfaanypaasilrav
    tlpnyggstlwantatayaelpeplkclvenlwalhtnrydyvaneavqaltdtqqafrq
    afqkpdfrtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrritspenti
    rwnwesgdvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisgaplal
    ag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swtA (A:)
    litvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddqqqlqfag
    llgtpianrwhtdvtfaanypaasilravtlpnyggstlwantatayaelpeplkclven
    lwalhtnrpdfrtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrritsp
    entirwnwesgdvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisga
    plal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3swtB (B:)
    gpgsmtdlitvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddq
    qqlqfagllgtpighpaaaaalpdapiitpinsewgkanrwhtdvtfaanypaasilrav
    tlpnyggstlwantatayaelpeplkclvenlwalhtnrydyvaneavqaltdtqqafrq
    afqkpdfrtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrritspenti
    rwnwesgdvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisgaplal
    ag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swtB (B:)
    litvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddqqqlqfag
    llgtpighnrwhtdvtfaanypaasilravtlpnyggstlwantatayaelpeplkclve
    nlwalhtnrpdfrtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrrits
    pentirwnwesgdvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisg
    aplala