PDB entry 3swn

View 3swn on RCSB PDB site
Description: Structure of the LSm657 Complex: An Assembly Intermediate of the LSm1 7 and LSm2 8 Rings
Class: RNA binding protein
Keywords: Sm, rna metabolism, rna, nuclear, RNA BINDING PROTEIN
Deposited on 2011-07-14, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm5, SPBC20F10.09
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swna_
  • Chain 'B':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm6, SPAC2F3.17c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swnb_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm7, SPCC285.12
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm5, SPBC20F10.09
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swnd_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm6, SPAC2F3.17c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swne_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm7, SPCC285.12
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm7, SPCC285.12
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm5, SPBC20F10.09
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swnp_
  • Chain 'Q':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm6, SPAC2F3.17c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swnq_
  • Chain 'R':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm7, SPCC285.12
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm5, SPBC20F10.09
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swns_
  • Chain 'T':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm6, SPAC2F3.17c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swnt_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3swnA (A:)
    mgmsmtilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvte
    khsemllngngmcmlipggkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnA (A:)
    tilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsem
    llngngmcmlipggkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3swnB (B:)
    mgmdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvyg
    dafirgnnvlyvsaldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnB (B:)
    sspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygdafi
    rgnnvlyvsal
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3swnD (D:)
    mgmsmtilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvte
    khsemllngngmcmlipggkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnD (D:)
    ilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhseml
    lngngmcmlipgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3swnE (E:)
    mgmdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvyg
    dafirgnnvlyvsaldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnE (E:)
    sspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygdafi
    rgnnvlyvsald
    

  • Chain 'F':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3swnP (P:)
    mgmsmtilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvte
    khsemllngngmcmlipggkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnP (P:)
    tilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsem
    llngngmcmlipggkp
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3swnQ (Q:)
    mgmdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvyg
    dafirgnnvlyvsaldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnQ (Q:)
    mdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygda
    firgnnvlyvsal
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3swnS (S:)
    mgmsmtilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvte
    khsemllngngmcmlipggkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnS (S:)
    lplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsemll
    ngngmcmlipgg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3swnT (T:)
    mgmdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvyg
    dafirgnnvlyvsaldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swnT (T:)
    sspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygdafi
    rgnnvlyvsald