PDB entry 3swb

View 3swb on RCSB PDB site
Description: Crystal structure of the amino-terminal domain of human cardiac troponin C in complex with cadmium at 1.7 A resolution
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2011-07-13, released 2012-07-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.136
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3swba_
  • Heterogens: CD, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3swbA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swbA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdegtvdfdeflvmmvrcmkdds