PDB entry 3svw

View 3svw on RCSB PDB site
Description: Crystal Structure of the P107V-MauG/pre-Methylamine Dehydrogenase Complex
Class: oxidoreductase/electron transport
Keywords: MauG, methylamine dehydrogenase, c-heme, quinone cofactor, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2011-07-12, released 2012-05-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.134
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (106)
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (106)
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • expression tag (131-136)
    Domains in SCOPe 2.05: d3svwc_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3svwd_
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3svwe_
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3svwf_
  • Heterogens: CA, NA, HEC, PGE, PEG, EDO, ACT, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3svwC (C:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3svwC (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkashhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3svwD (D:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3svwD (D:)
    qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
    vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
    prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
    tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
    qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
    rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
    nqlghgpqvittadmg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3svwE (E:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3svwE (E:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3svwF (F:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3svwF (F:)
    qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
    vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
    prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
    tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
    qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
    rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
    nqlghgpqvittadmg