PDB entry 3sv0

View 3sv0 on RCSB PDB site
Description: Crystal structure of casein kinase-1 like protein in plant
Class: Transferase
Keywords: kinase, Typical kinase domain fold, cytosol, Transferase
Deposited on 2011-07-12, released 2012-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I-like
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3sv0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sv0A (A:)
    meprvgnkfrlgrkigsgsfgeiylgtniqtneevaiklenvktkhpqllyeskiyrilq
    ggtgipnvrwfgvegdynvlvmdllgpsledlfnfcsrklslktvlmladqminrvefvh
    sksflhrdikpdnflmglgrranqvyiidfglakkyrdtsthqhipyrenknltgtarya
    svnthlgieqsrrddleslgyvlmyflrgslpwqglkagtkkqkyekisekkvatsieal
    crgyptefasyfhycrslrfddkpdysylkrlfrdlfiregfqfdyvfdwtilkyqqsqi
    asappravghgagpsglappalqndrqsgvdegrtsgwssmdrrrapppiasvgtlakqk
    apvgndasfskepvisasnflgrssgssrrpavsssrdvmpidtsepsrtratdaspgaf
    rrtsgpqksspvnsaepkhsssarhssnvknyesalkgieglnfdgdervqyaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sv0A (A:)
    eprvgnkfrlgrkigsgsfgeiylgtniqtneevaiklenvktkhpqllyeskiyrilqg
    gtgipnvrwfgvegdynvlvmdllgpsledlfnfcsrklslktvlmladqminrvefvhs
    ksflhrdikpdnflmglgrranqvyiidfglakkyrdtsthqhipyrenknltgtaryas
    vnthlgieqsrrddleslgyvlmyflrgslpwqglkagtkkqkyekisekkvatsiealc
    rgyptefasyfhycrslrfddkpdysylkrlfrdlfiregfqfdyvfdwtilky