PDB entry 3stm

View 3stm on RCSB PDB site
Description: Structure of human LFABP in complex with one molecule of palmitic acid
Class: lipid binding protein
Keywords: LFABP, Palmitic acid, Fatty acid binding, LIPID BINDING PROTEIN
Deposited on 2011-07-11, released 2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Fatty acid-binding protein, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (4-129)
      • expression tag (130)
    Domains in SCOPe 2.08: d3stmx1, d3stmx2
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >3stmX (X:)
magssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagsk
viqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgd
ivfkriskrigt

    Sequence, based on observed residues (ATOM records): (download) 
    >3stmX (X:)
sfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviqn
eftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivfk
riskrig