PDB entry 3st5

View 3st5 on RCSB PDB site
Description: Crystal structure of wild-type HIV-1 protease with C3-Substituted Hexahydrocyclopentafuranyl Urethane as P2-Ligand, GRL-0489A
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic acid protease, HIV-1 protease inhibitor GRL-0489A, C3-Substituted Hexahydrocyclopentafuranyl Urethane as P2-ligands, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-07-08, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.16
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 [TaxId:11686]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.07: d3st5a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 [TaxId:11686]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.07: d3st5b_
• Heterogens: CL, G89, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3st5A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3st5B (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf