PDB entry 3st5
View 3st5 on RCSB PDB site
Description: Crystal structure of wild-type HIV-1 protease with C3-Substituted Hexahydrocyclopentafuranyl Urethane as P2-Ligand, GRL-0489A
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic acid protease, HIV-1 protease inhibitor GRL-0489A, C3-Substituted Hexahydrocyclopentafuranyl Urethane as P2-ligands, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-07-08, released
2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-08-31, with a file datestamp of
2011-08-26.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.16
AEROSPACI score: 0.68
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.07: d3st5a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.07: d3st5b_ - Heterogens: CL, G89, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3st5A (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3st5B (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf