PDB entry 3ssi

View 3ssi on RCSB PDB site
Description: proteinase inhibitor ssi (streptomyces subtilisin, inhibitor) from streptomyces albogriseolus
Class: serine protease inhibitor
Keywords: ssi, serine protease inhibitor, subtilisin bpn
Deposited on 1996-03-01, released 1996-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptomyces subtilisin inhibitor
    Species: Streptomyces albogriseolus [TaxId:1887]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ssia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ssiA (A:)
dapsalyapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdl
naltrgedvmcpmvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

    Sequence, based on observed residues (ATOM records): (download) 
    >3ssiA (A:)
lyapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltr
gedvmcpmvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf