PDB entry 3ssg

View 3ssg on RCSB PDB site
Description: Structure of transthyretin L55P in complex with Zn
Class: hormone
Keywords: amyloid, transthyretin, HORMONE
Deposited on 2011-07-08, released 2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (54)
    Domains in SCOPe 2.08: d3ssga_
  • Heterogens: ZN, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ssgA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ssgA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp