PDB entry 3sry

View 3sry on RCSB PDB site
Description: Engineered high-affinity halide-binding protein derived from YFP: halide-free
Class: halide binding protein
Keywords: beta barrel, luminescent protein, yellow fluorescent protein, imaging reagent, HALIDE BINDING PROTEIN
Deposited on 2011-07-07, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (0-End)
      • insertion (1)
      • chromophore (66)
      • engineered mutation (72)
      • engineered mutation (79)
      • engineered mutation (183)
      • engineered mutation (203)
    Domains in SCOPe 2.07: d3srya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sryA (A:)
    mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttfgygvqcfarypdhmrqhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
    dhyaqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmdelykg
    gsndykddddkggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sryA (A:)
    mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttfgygvqcfarypdhmrqhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
    dhyaqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitely