PDB entry 3srx

View 3srx on RCSB PDB site
Description: New Delhi Metallo-beta-Lactamase-1 Complexed with Cd
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, alpha-beta sandwich, hydrolase, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI
Deposited on 2011-07-07, released 2011-07-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase NDM-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (3-236)
      • expression tag (0-2)
      • engineered mutation (3-4)
    Domains in SCOPe 2.01: d3srxa_
  • Chain 'B':
    Compound: Beta-lactamase NDM-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3srxb_
  • Heterogens: CD, GOL, CL, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3srxA (A:)
    snanymetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
    tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
    mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
    kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3srxB (B:)
    snanymetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
    tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
    mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
    kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3srxB (B:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr