PDB entry 3srt

View 3srt on RCSB PDB site
Description: The crystal structure of a maltose O-acetyltransferase from Clostridium difficile 630
Class: transferase
Keywords: maltose O-acetyltransferase, structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2011-07-07, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.165
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD0872, CD630_08720, maa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18A66 (3-187)
      • expression tag (2)
    Domains in SCOPe 2.07: d3srta1, d3srta2
  • Chain 'B':
    Compound: maltose o-acetyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD0872, CD630_08720, maa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18A66 (3-187)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3srtb1, d3srtb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3srtA (A:)
    snamtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvg
    kqinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpida
    qlrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpc
    rvikkiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3srtA (A:)
    amtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkq
    inveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaql
    rnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrv
    ikkiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3srtB (B:)
    snamtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvg
    kqinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpida
    qlrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpc
    rvikkiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3srtB (B:)
    namtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgk
    qinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaq
    lrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcr
    vikkiee