PDB entry 3srn

View 3srn on RCSB PDB site
Description: structural changes that accompany the reduced catalytic efficiency of two semisynthetic ribonuclease analogs
Class: hydrolase(nucleic acid,RNA)
Keywords: hydrolase(nucleic acid,RNA)
Deposited on 1991-05-20, released 1994-12-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-112)
  Domains in SCOPe 2.05: d3srn.1
• Chain 'B':
  Compound: ribonuclease a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-9)
    • insertion (7)
  Domains in SCOPe 2.05: d3srn.1
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3srnA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3srnB (B:)
  pyvpvhfnasv