PDB entry 3srn

View 3srn on RCSB PDB site
Description: structural changes that accompany the reduced catalytic efficiency of two semisynthetic ribonuclease analogs
Deposited on 1991-05-20, released 1994-12-20
The last revision prior to the SCOP 1.57 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3srn.1
  • Chain 'B':
    Domains in SCOP 1.57: d3srn.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3srnA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3srnB (B:)
pyvpvhfnasv