PDB entry 3srn

View 3srn on RCSB PDB site
Description: structural changes that accompany the reduced catalytic efficiency of two semisynthetic ribonuclease analogs
Class: hydrolase(nucleic acid,RNA)
Keywords: hydrolase(nucleic acid, RNA)
Deposited on 1991-05-20, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3srn.1
  • Chain 'B':
    Compound: ribonuclease a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-9)
      • insertion (7)
    Domains in SCOPe 2.08: d3srn.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3srnA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3srnB (B:)
    pyvpvhfnasv