PDB entry 3sqo

View 3sqo on RCSB PDB site
Description: PCSK9 J16 Fab complex
Class: HYDROLASE/Immune system
Keywords: cholesterol regulation, LDLR, HYDROLASE-Immune system complex
Deposited on 2011-07-05, released 2012-05-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBP7 (0-End)
      • conflict (321)
      • conflict (517)
  • Chain 'H':
    Compound: J16 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQO (0-End)
  • Chain 'L':
    Compound: J16 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQO (Start-213)
    Domains in SCOPe 2.05: d3sqol1, d3sqol2
  • Chain 'P':
    Compound: PCSK9 prodomain
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3sqoL (L:)
diqmtqspsslsasvgdrvtitcrasqgissalawyqqkpgkapklliysasyrytgvps
rfsgsgsgtdftftisslqpediatyycqqryslwrtfgqgtkleikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrges

    Sequence, based on observed residues (ATOM records): (download) 
    >3sqoL (L:)
iqmtqspsslsasvgdrvtitcrasqgissalawyqqkpgkapklliysasyrytgvpsr
fsgsgsgtdftftisslqpediatyycqqryslwrtfgqgtkleikrtvaapsvfifpps
deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
skadyekhkvyacevthqglsspvtksfnrges

  • Chain 'P':
    No sequence available.