PDB entry 3sqh

View 3sqh on RCSB PDB site
Description: Crystal structure of prethrombin-2 mutant S195A in the the open form
Class: hydrolase
Keywords: Serine protease, HYDROLASE
Deposited on 2011-07-05, released 2011-11-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Thrombin light chain, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2, human cDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (3-289)
      • engineered mutation (235)
    Domains in SCOPe 2.01: d3sqhe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sqhE (E:)
    eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
    aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
    ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
    anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpf
    vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqhE (E:)
    eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
    aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
    ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
    apsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpfvmkspf
    nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge