PDB entry 3sqg

View 3sqg on RCSB PDB site
Description: Crystal structure of a methyl-coenzyme M reductase purified from Black Sea mats
Class: transferase
Keywords: anaerobic methane oxidation, TRANSFERASE
Deposited on 2011-07-05, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl coenzyme M reductase, alpha subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sqga1, d3sqga2
  • Chain 'B':
    Compound: Methyl-coenzyme M reductase, beta subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sqgb1, d3sqgb2
  • Chain 'C':
    Compound: Methyl-coenzyme M reductase, gamma subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Methyl coenzyme M reductase, alpha subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sqgd1, d3sqgd2
  • Chain 'E':
    Compound: Methyl-coenzyme M reductase, beta subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sqge1, d3sqge2
  • Chain 'F':
    Compound: Methyl-coenzyme M reductase, gamma subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Methyl coenzyme M reductase, alpha subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sqgg1, d3sqgg2
  • Chain 'H':
    Compound: Methyl-coenzyme M reductase, beta subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sqgh1, d3sqgh2
  • Chain 'I':
    Compound: Methyl-coenzyme M reductase, gamma subunit
    Species: uncultured archaeon [TaxId:115547]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TP7, COM, M43, 1PE, PGE, SO4, CL, CA, P6G, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sqgA (A:)
    mpyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvns
    tpaynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlgldda
    hgllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddl
    vdsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrw
    vgmqvgmtminayklcagesvtgefayyakhaavvqlsnympvkrarshnepggmplgin
    adstrspalfpndpiraelesiavaamvydqlwfgtymsggvgftqyasatytdniledf
    cykgceigldyaggkmasikgdklnmdileeiiraendyaltqyeayptvaeshfggsvr
    accaaagcgsavacatglaqpalsawslsmlghyervgrlgffgydlqdqctacgsysyq
    sdegmpfemrgvnypnyamnvghqsayaglvagahsanhdawvlsplwkvafsdrdlpfd
    rgyvtreyglganreytkvagerdliiaghygrepgakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqgA (A:)
    pyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvnst
    paynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlglddah
    gllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddlv
    dsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrwv
    gmqvgmtminayklcagesvtgefayyakhaavvqlsnympvkrarshnepggmplgina
    dstrspalfpndpiraelesiavaamvydqlwfgtymsggvgftqyasatytdniledfc
    ykgceigldyaggkmasikgdklnmdileeiiraendyaltqyeayptvaeshfggsvra
    ccaaagcgsavacatglaqpalsawslsmlghyervgrlgffgydlqdqctacgsysyqs
    degmpfemrgvnypnyamnvghqsayaglvagahsanhdawvlsplwkvafsdrdlpfdr
    gyvtreyglganreytkvagerdliiaghygrepgakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sqgB (B:)
    madeidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaia
    grgmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarils
    dysvgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkn
    egpgftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayeg
    lnannllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwna
    yactamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffsh
    siyggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipe
    faepmravaeaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqgB (B:)
    deidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaiagr
    gmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarilsdy
    svgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkneg
    pgftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayegln
    annllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwnaya
    ctamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffshsi
    yggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipefa
    epmravaeaak
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sqgD (D:)
    mpyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvns
    tpaynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlgldda
    hgllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddl
    vdsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrw
    vgmqvgmtminayklcagesvtgefayyakhaavvqlsnympvkrarshnepggmplgin
    adstrspalfpndpiraelesiavaamvydqlwfgtymsggvgftqyasatytdniledf
    cykgceigldyaggkmasikgdklnmdileeiiraendyaltqyeayptvaeshfggsvr
    accaaagcgsavacatglaqpalsawslsmlghyervgrlgffgydlqdqctacgsysyq
    sdegmpfemrgvnypnyamnvghqsayaglvagahsanhdawvlsplwkvafsdrdlpfd
    rgyvtreyglganreytkvagerdliiaghygrepgakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqgD (D:)
    pyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvnst
    paynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlglddah
    gllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddlv
    dsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrwv
    gmqvgmtminayklcagesvtgefayyakhaavvqlsnympvkrarshnepggmplgina
    dstrspalfpndpiraelesiavaamvydqlwfgtymsggvgftqyasatytdniledfc
    ykgceigldyaggkmasikgdklnmdileeiiraendyaltqyeayptvaeshfggsvra
    ccaaagcgsavacatglaqpalsawslsmlghyervgrlgffgydlqdqctacgsysyqs
    degmpfemrgvnypnyamnvghqsayaglvagahsanhdawvlsplwkvafsdrdlpfdr
    gyvtreyglganreytkvagerdliiaghygrepgakl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sqgE (E:)
    madeidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaia
    grgmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarils
    dysvgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkn
    egpgftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayeg
    lnannllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwna
    yactamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffsh
    siyggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipe
    faepmravaeaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqgE (E:)
    deidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaiagr
    gmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarilsdy
    svgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkneg
    pgftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayegln
    annllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwnaya
    ctamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffshsi
    yggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipefa
    epmravaeaak
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3sqgG (G:)
    mpyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvns
    tpaynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlgldda
    hgllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddl
    vdsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrw
    vgmqvgmtminayklcagesvtgefayyakhaavvqlsnympvkrarshnepggmplgin
    adstrspalfpndpiraelesiavaamvydqlwfgtymsggvgftqyasatytdniledf
    cykgceigldyaggkmasikgdklnmdileeiiraendyaltqyeayptvaeshfggsvr
    accaaagcgsavacatglaqpalsawslsmlghyervgrlgffgydlqdqctacgsysyq
    sdegmpfemrgvnypnyamnvghqsayaglvagahsanhdawvlsplwkvafsdrdlpfd
    rgyvtreyglganreytkvagerdliiaghygrepgakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqgG (G:)
    pyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvnst
    paynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlglddah
    gllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddlv
    dsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrwv
    gmqvgmtminayklcagesvtgefayyakhaavvqlsnympvkrarshnepggmplgina
    dstrspalfpndpiraelesiavaamvydqlwfgtymsggvgftqyasatytdniledfc
    ykgceigldyaggkmasikgdklnmdileeiiraendyaltqyeayptvaeshfggsvra
    ccaaagcgsavacatglaqpalsawslsmlghyervgrlgffgydlqdqctacgsysyqs
    degmpfemrgvnypnyamnvghqsayaglvagahsanhdawvlsplwkvafsdrdlpfdr
    gyvtreyglganreytkvagerdliiaghygrepgakl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3sqgH (H:)
    madeidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaia
    grgmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarils
    dysvgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkn
    egpgftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayeg
    lnannllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwna
    yactamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffsh
    siyggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipe
    faepmravaeaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqgH (H:)
    deidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaiagr
    gmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarilsdy
    svgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkneg
    pgftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayegln
    annllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwnaya
    ctamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffshsi
    yggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipefa
    epmravaeaak
    

  • Chain 'I':
    No sequence available.