PDB entry 3sqa

View 3sqa on RCSB PDB site
Description: Crystal Structure of the UCH domain of UCH-L5 with 6 residues deleted
Class: hydrolase
Keywords: UCH-L5, UCH37, Hydrolase
Deposited on 2011-07-05, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH-L5, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K5
      • engineered mutation (89)
    Domains in SCOPe 2.07: d3sqaa_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH-L5, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K5
      • engineered mutation (89)
    Domains in SCOPe 2.07: d3sqab_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sqaA (A:)
    gsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkw
    qpgeepagsvvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefs
    qsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyel
    dglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqaA (A:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
    viekriqkysegeirfnlmaivsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sqaB (B:)
    gsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkw
    qpgeepagsvvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefs
    qsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyel
    dglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sqaB (B:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
    viekriqkysegeirfnlmaivsd