PDB entry 3sq6

View 3sq6 on RCSB PDB site
Description: Crystal Structures of the Ligand Binding Domain of a Pentameric Alpha7 Nicotinic Receptor Chimera with its Agonist Epibatidine
Class: TRANSPORT PROTEIN/Receptor/Agonist
Keywords: Nicotinic Receptor, TRANSPORT PROTEIN-Receptor-Agonist complex
Deposited on 2011-07-05, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (0-203)
    Domains in SCOPe 2.07: d3sq6a_
  • Chain 'B':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (0-203)
    Domains in SCOPe 2.07: d3sq6b_
  • Chain 'C':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (Start-203)
    Domains in SCOPe 2.07: d3sq6c_
  • Chain 'D':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (0-203)
    Domains in SCOPe 2.07: d3sq6d_
  • Chain 'E':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (Start-203)
    Domains in SCOPe 2.07: d3sq6e_
  • Chain 'F':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (Start-203)
    Domains in SCOPe 2.07: d3sq6f_
  • Chain 'G':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (Start-203)
    Domains in SCOPe 2.07: d3sq6g_
  • Chain 'H':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (Start-203)
    Domains in SCOPe 2.07: d3sq6h_
  • Chain 'I':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (0-203)
    Domains in SCOPe 2.07: d3sq6i_
  • Chain 'J':
    Compound: Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Gene: CHRNA7
    Database cross-references and differences (RAF-indexed):
    • PDB 3SQ6 (Start-203)
    Domains in SCOPe 2.07: d3sq6j_
  • Heterogens: EPJ, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sq6A (A:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sq6B (B:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sq6C (C:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sq6C (C:)
    fqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdh
    ylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirq
    rfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrse
    rfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sq6D (D:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sq6E (E:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sq6E (E:)
    qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
    lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
    fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
    fyecckepypdvtftvtfrkkg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3sq6F (F:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sq6F (F:)
    qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
    lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
    fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
    fyecckepypdvtftvtfrkkg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3sq6G (G:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sq6G (G:)
    qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
    lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
    fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
    fyecckepypdvtftvtfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3sq6H (H:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sq6H (H:)
    fqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdh
    ylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirq
    rfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrse
    rfyecckepypdvtftvtfrkkg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sq6I (I:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3sq6J (J:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sq6J (J:)
    qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
    lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
    fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
    fyecckepypdvtftvtfrkkg