PDB entry 3spt

View 3spt on RCSB PDB site
Description: Crystal structure of GlmU from Mycobacterium tuberculosis in complex with ACETYL COENZYME A and URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE
Class: transferase
Keywords: acetyltransferase, bifunctional, pyrophosphorylase, rossmann-like fold, left-handed-beta-helix, cell shape, cell wall biogenesis/degradation, metal-binding, multifunctional enzyme, nucleotidyltransferase, peptidoglycan synthesis, transferase, acyltransferase
Deposited on 2011-07-03, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: glmU, MT1046, Rv1018c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spta1, d3spta2
  • Heterogens: MG, ACO, UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sptA (A:)
    hhhhhhmtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrliv
    vlghdhqriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgd
    tplldadtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsq
    reirevnagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsal
    vagvnnrvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllg
    rtqiggrcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgk
    lgafvevknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrt
    gsdtmfvapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqas
    krasemacqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sptA (A:)
    dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
    lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
    liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
    afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
    elaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvg
    pdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevknst
    igtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvt
    igdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrase