PDB entry 3spk

View 3spk on RCSB PDB site
Description: Tipranavir in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
Class: hydorlase/hydorlase inhibitor
Keywords: tipranavir, multi-drug resistant HIV-1 protease, HYDORLASE-HYDORLASE INHIBITOR complex
Deposited on 2011-07-01, released 2011-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.177
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: human immunodeficiency virus type 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • see remark 999 (6)
    • conflict (24)
    • conflict (34)
    • see remark 999 (35)
    • see remark 999 (45)
  Domains in SCOPe 2.02: d3spka_
• Chain 'B':
  Compound: hiv-1 protease
  Species: human immunodeficiency virus type 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • see remark 999 (6)
    • conflict (24)
    • conflict (34)
    • see remark 999 (35)
    • see remark 999 (45)
  Domains in SCOPe 2.02: d3spkb_
• Heterogens: TPV, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3spkA (A:)
  pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3spkB (B:)
  pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf