PDB entry 3sp9

View 3sp9 on RCSB PDB site
Description: Structural basis for iloprost as a dual PPARalpha/delta agonist
Class: transcription
Keywords: nuclear receptor LBD, nuclear receptor fold, ligand binding, gene transcription, drug binding, TRANSCRIPTION
Deposited on 2011-07-01, released 2011-07-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3sp9b_
  • Heterogens: IL2, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sp9B (B:)
    hhhhhhlvprgsadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlw
    qaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvt
    llkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfna
    lelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkll
    qkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sp9B (B:)
    adlkafskhiynaylknfnmtkkkarsiltgkhtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy