PDB entry 3sp7

View 3sp7 on RCSB PDB site
Description: Crystal Structure of Bcl-xL bound to BM903
Class: apoptosis regulator/inhibitor
Keywords: Bcl-2-like protein, APOPTOSIS REGULATOR-INHIBITOR complex
Deposited on 2011-07-01, released 2012-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Bcl-xl, Bcl2l, Bcl2l1, Bclx
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07817 (3-46)
      • expression tag (0-2)
    • Uniprot Q07817 (47-End)
    Domains in SCOPe 2.05: d3sp7a_
  • Heterogens: 03B, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sp7A (A:)
    sefmsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdef
    elryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdk
    emqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sp7A (A:)
    sefmsqsnrelvvdflsyklsqkgyswsqfsdeseavkqalreagdefelryrrafsdlt
    sqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaaw
    matylndhlepwiqenggwdtfvelygnna