PDB entry 3soz

View 3soz on RCSB PDB site
Description: Cytoplasmic Protein STM1381 from Salmonella typhimurium LT2
Class: Structural Genomics, Unknown Function
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Unknown Function, Structure and Function of Pathogen Secreted Proteins, Program for the Characterization of Secreted Effector Proteins, PCSEP
Deposited on 2011-06-30, released 2011-08-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytoplasmic Protein STM1381
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
  Gene: ORF 245, orf245, STM1381
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z4S4 (3-247)
• Chain 'B':
  Compound: Cytoplasmic Protein STM1381
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
  Gene: ORF 245, orf245, STM1381
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z4S4 (3-247)
• Chain 'C':
  Compound: Cytoplasmic Protein STM1381
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
  Gene: ORF 245, orf245, STM1381
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z4S4 (3-247)
  Domains in SCOPe 2.02: d3sozc_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3sozC (C:)
  snamkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtr
  fpqtaealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggy
  lsftgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppll
  gynkliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwc
  nvlhtikk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3sozC (C:)
  mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq
  taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf
  tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn
  kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl
  htikk