PDB entry 3sox

View 3sox on RCSB PDB site
Description: Structure of UHRF1 PHD finger in the free form
Class: ligase
Keywords: PHD finger, Histone binding, Histone H3, ligase
Deposited on 2011-06-30, released 2011-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICBP90, NP95, RNF106, UHRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3soxa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICBP90, NP95, RNF106, UHRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3soxb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3soxA (A:)
    sgpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsede
    wycpecrnda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3soxA (A:)
    gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
    ycpec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3soxB (B:)
    sgpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsede
    wycpecrnda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3soxB (B:)
    gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
    ycpec